| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
| Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
| Protein MAP kinase Erk2 [56134] (2 species) CMGC group; ERK/MAPK subfamily; serine/threonine kinase |
| Species Human (Homo sapiens) [TaxId:9606] [56135] (74 PDB entries) |
| Domain d4iz5b_: 4iz5 B: [252765] automated match to d3sa0a_ complexed with adp, so4; mutant |
PDB Entry: 4iz5 (more details), 3.19 Å
SCOPe Domain Sequences for d4iz5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iz5b_ d.144.1.7 (B:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]}
pemvrgqvfdvgprytnlsyigegaygmvcsaydnvnkvrvaikkispfehqtycqrtlr
eikillrfrheniigindiiraptieqmkdvyivqdlmetdlykllktqhlsndhicyfl
yqilrglkyihsanvlhrdlkpsnlllnttcdlkicdfglarvadpdhdhtgfleeyvat
rwyrapeimlnskgytksidiwsvgcilaemlsnrpifpgkhyldqlnhilgilgspsqe
dlnciinlkarnyllslphknkvpwnrlfpnadskaldlldkmltfnphkrieveqalah
pyleqyydpsdepiaeapfkfdmelddlpkeklkelifeetarfqpg
Timeline for d4iz5b_: