| Class b: All beta proteins [48724] (178 folds) |
| Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
| Family b.40.4.2: DNA helicase RuvA subunit, N-terminal domain [50259] (1 protein) barrel, closed; n=5, S=10 automatically mapped to Pfam PF01330 |
| Protein DNA helicase RuvA subunit, N-terminal domain [50260] (3 species) tetramer; binds Holliday junction |
| Species Mycobacterium leprae [TaxId:1769] [50262] (1 PDB entry) |
| Domain d1bvsc3: 1bvs C:1-63 [25276] Other proteins in same PDB: d1bvsa1, d1bvsa2, d1bvsb1, d1bvsb2, d1bvsc1, d1bvsc2, d1bvsd1, d1bvsd2, d1bvse1, d1bvse2, d1bvsf1, d1bvsf2, d1bvsg1, d1bvsg2, d1bvsh1, d1bvsh2 protein/DNA complex |
PDB Entry: 1bvs (more details), 3 Å
SCOPe Domain Sequences for d1bvsc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bvsc3 b.40.4.2 (C:1-63) DNA helicase RuvA subunit, N-terminal domain {Mycobacterium leprae [TaxId: 1769]}
mifsvrgevlevaldhavieaagigyrvnatpsalatlnqgsqarlvtamvvredsmtly
gfs
Timeline for d1bvsc3: