SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4iymf_ (4iym F:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (40 species)
    not a true protein
  7. 2141563Species Sinorhizobium meliloti [TaxId:266834] [226320] (9 PDB entries)
  8. 2141573Domain d4iymf_: 4iym F: [252753]
    Other proteins in same PDB: d4iymc2, d4iyme2, d4iymo2
    automated match to d3k2wb_
    complexed with mg, nad

Details for d4iymf_

PDB Entry: 4iym (more details), 2.2 Å

PDB Description: Crystal structure of putative methylmalonate-semialdehyde dehydrogenase from Sinorhizobium meliloti 1021 complexed with NAD, target 011934
PDB Compounds: (F:) Methylmalonate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d4iymf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iymf_ c.82.1.0 (F:) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
myelghfidgkrvagtsgrvsnifnpatgevqgtvalasdadlaaavesakaaqpkwaat
npqrrarvfmkfvqllndnmnelaemlsrehgktiddakgdivrglevcefvigiphlqk
seftegagpgidmysirqpvgigagitpfnfpgmipmwmfapaiacgnafilkpserdps
vpirlaelmieaglpagilnvvngdkgavdailthpdiaavsfvgstpiaryvygtaamn
gkraqcfggaknhmiimpdadldqaanaligagygsagercmaisvavpvgeetanrlid
klvpmveslrigpytdekadmgpvvtkeaeqrirslidsgieqgaklvvdgrdfklqgye
nghfiggclfddvtpdmdiykteifgpvlsvvrarnyeealslpmkheygngvaiytrdg
daardfasrinigmvgvnvpipvplayhsfggwksssfgdlnqhgtdsikfwtrtktits
rwpsgikd

SCOPe Domain Coordinates for d4iymf_:

Click to download the PDB-style file with coordinates for d4iymf_.
(The format of our PDB-style files is described here.)

Timeline for d4iymf_: