SCOPe 2.08: Domain d4ixla1: 4ixl A:0-200

Lineage for d4ixla1 (4ixl A:0-200)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein automated matches [190135] (18 species)
   not a true protein

7. Species Bacillus sp [TaxId:1409] [256315] (1 PDB entry)

8. Domain d4ixla1: 4ixl A:0-200 [252746]
   Other proteins in same PDB: d4ixla2, d4ixlb2
   automated match to d1igoa_
   complexed with so4

Details for d4ixla1

PDB Entry: 4ixl, 1.49 Å

PDB Description: Crystal structure of endo-beta-1,4-xylanase from the alkaliphilic Bacillus sp. SN5

PDB Compounds: (A:) xylanase

SCOPe Domain Sequences for d4ixla1:

Sequence; same for both SEQRES and ATOM records:

>d4ixla1 b.29.1.11 (A:0-200) automated matches {Bacillus sp [TaxId: 1409]}
sqitgneigthdgydyefwkdeggygsmtlnsggtfsaewtdvhnilfrkgqkfdttqth
qqlgninidygvnyqpngssylavygwttdplvefyivdswgtwrppgaeskgtihvdgg
tyeiyettrvqqpsiegtatfqqywsvrtdkrtsgtisvsehfhaweahgmpmgnmyeva
ltvegwqssgsadvyrnnlti

Timeline for d4ixla1:

• d4ixla1 first appeared in SCOPe 2.04, called d4ixla_
  
• d4ixla1 appears in SCOPe 2.07