Lineage for d4ix8b_ (4ix8 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132616Species Leishmania infantum [TaxId:5671] [256314] (1 PDB entry)
  8. 2132618Domain d4ix8b_: 4ix8 B: [252745]
    automated match to d1bw0b_
    complexed with cl

Details for d4ix8b_

PDB Entry: 4ix8 (more details), 2.35 Å

PDB Description: crystal structure of tyrosine aminotransferase from leishmania infantum
PDB Compounds: (B:) Tyrosine aminotransferase

SCOPe Domain Sequences for d4ix8b_:

Sequence, based on SEQRES records: (download)

>d4ix8b_ c.67.1.0 (B:) automated matches {Leishmania infantum [TaxId: 5671]}
sfrriasskhaqrtlqplnnltdnmkpsrstksnlrlsigdptvdgnlktpdivteamvd
vvrsgkfngypptvgadnlrqvvstywrrfcqtksrqealkwenviitsgvsqaivlalt
alcnegdnilvcapsfphyksvcdsygiecryyyldpskswecdlraaagmvdshtkafv
iinpsnpcgsnfsrahvsdiidfcqqhqiplisdeiyaemvlnngiftsvadfdtnvprl
ilggtakyqvcpgwrvgwsilidpmnvagdwavgmerltqliagvnsicqeaiartllkc
ptectehivtqleagakvyarllehdigismeapqasmfvmlklnlsyfqdlksdmefye
klldeenvqvlpgeifgmsgflratvsrpsavlneavdri

Sequence, based on observed residues (ATOM records): (download)

>d4ix8b_ c.67.1.0 (B:) automated matches {Leishmania infantum [TaxId: 5671]}
sfrriasskhaqrtlqplnnltnlrlsigdptvdgnlktpdivteamvdvvrsgkfngyp
ptvgadnlrqvvstywrrfcqtksrqealkwenviitsgvsqaivlaltalcnegdnilv
capsfphyksvcdsygiecryyyldpskswecdlraaagmvdshtkafviinpsnpcgsn
fsrahvsdiidfcqqhqiplisdeiyaemvlnngiftsvadfdtnvprlilggtakyqvc
pgwrvgwsilidpmnvagdwavgmerltqliagvnsicqeaiartllkcptectehivtq
leagakvyarllismeapqasmfvmldmefyeklldnvqvlpgeifgmsgflratvsrps
avlneavdri

SCOPe Domain Coordinates for d4ix8b_:

Click to download the PDB-style file with coordinates for d4ix8b_.
(The format of our PDB-style files is described here.)

Timeline for d4ix8b_: