SCOPe 2.06: Domain d4iwmf_: 4iwm F:

Lineage for d4iwmf_ (4iwm F:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.135: NIF3 (NGG1p interacting factor 3)-like [102704] (1 superfamily)
   consist of two intertwined domains; duplication: contains two structural repeats of alpha-beta-(beta-alpha)3 motif with mixed beta-sheet, order: 1432, strand 1 is antiparallel to the rest

4. Superfamily c.135.1: NIF3 (NGG1p interacting factor 3)-like [102705] (2 families)
   di-iron binding protein

5. Family c.135.1.0: automated matches [191472] (1 protein)
   not a true family

6. Protein automated matches [190747] (3 species)
   not a true protein

7. Species Methanocaldococcus jannaschii [TaxId:243232] [236411] (8 PDB entries)

8. Domain d4iwmf_: 4iwm F: [252743]
   automated match to d4iwga_

Details for d4iwmf_

PDB Entry: 4iwm, 2.7 Å

PDB Description: crystal structure of the conserved hypothetical protein mj0927 from methanocaldococcus jannaschii (in p21 form)

PDB Compounds: (F:) UPF0135 protein MJ0927

SCOPe Domain Sequences for d4iwmf_:

Sequence; same for both SEQRES and ATOM records:

>d4iwmf_ c.135.1.0 (F:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
mkakeiiefietfapkdlaiegdniglqvgdnldkeikklgialdpslsvikkaekegvd
flfthhpllkdpirnftgviykklkilmendiilysahtnldicknglndalaelynlen
pkplydnglgrvgifkgsfeefleitkkyihknpivvkskevddnfklavlsgyglsqss
ikyvaekadvylsgdlthhskilaeelglvvvdathystevfglkkfkeflssnldleii
sldf

Timeline for d4iwmf_:

• d4iwmf_ first appeared in SCOPe 2.04
  
• d4iwmf_ appears in SCOPe 2.05
  
• d4iwmf_ appears in SCOPe 2.07
  
• d4iwmf_ appears in the current release, SCOPe 2.08