Lineage for d4iwme_ (4iwm E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923316Fold c.135: NIF3 (NGG1p interacting factor 3)-like [102704] (1 superfamily)
    consist of two intertwined domains; duplication: contains two structural repeats of alpha-beta-(beta-alpha)3 motif with mixed beta-sheet, order: 1432, strand 1 is antiparallel to the rest
  4. 2923317Superfamily c.135.1: NIF3 (NGG1p interacting factor 3)-like [102705] (2 families) (S)
    di-iron binding protein
  5. 2923343Family c.135.1.0: automated matches [191472] (1 protein)
    not a true family
  6. 2923344Protein automated matches [190747] (3 species)
    not a true protein
  7. 2923345Species Methanocaldococcus jannaschii [TaxId:243232] [236411] (8 PDB entries)
  8. 2923395Domain d4iwme_: 4iwm E: [252742]
    automated match to d4iwga_

Details for d4iwme_

PDB Entry: 4iwm (more details), 2.7 Å

PDB Description: crystal structure of the conserved hypothetical protein mj0927 from methanocaldococcus jannaschii (in p21 form)
PDB Compounds: (E:) UPF0135 protein MJ0927

SCOPe Domain Sequences for d4iwme_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iwme_ c.135.1.0 (E:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
mkakeiiefietfapkdlaiegdniglqvgdnldkeikklgialdpslsvikkaekegvd
flfthhpllkdpirnftgviykklkilmendiilysahtnldicknglndalaelynlen
pkplydnglgrvgifkgsfeefleitkkyihknpivvkskevddnfklavlsgyglsqss
ikyvaekadvylsgdlthhskilaeelglvvvdathystevfglkkfkeflssnldleii
sldf

SCOPe Domain Coordinates for d4iwme_:

Click to download the PDB-style file with coordinates for d4iwme_.
(The format of our PDB-style files is described here.)

Timeline for d4iwme_: