![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.135: NIF3 (NGG1p interacting factor 3)-like [102704] (1 superfamily) consist of two intertwined domains; duplication: contains two structural repeats of alpha-beta-(beta-alpha)3 motif with mixed beta-sheet, order: 1432, strand 1 is antiparallel to the rest |
![]() | Superfamily c.135.1: NIF3 (NGG1p interacting factor 3)-like [102705] (2 families) ![]() di-iron binding protein |
![]() | Family c.135.1.0: automated matches [191472] (1 protein) not a true family |
![]() | Protein automated matches [190747] (3 species) not a true protein |
![]() | Species Methanocaldococcus jannaschii [TaxId:243232] [236411] (8 PDB entries) |
![]() | Domain d4iwma_: 4iwm A: [252738] automated match to d4iwga_ |
PDB Entry: 4iwm (more details), 2.7 Å
SCOPe Domain Sequences for d4iwma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iwma_ c.135.1.0 (A:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]} mkakeiiefietfapkdlaiegdniglqvgdnldkeikklgialdpslsvikkaekegvd flfthhpllkdpirnftgviykklkilmendiilysahtnldicknglndalaelynlen pkplydnglgrvgifkgsfeefleitkkyihknpivvkskevddnfklavlsgyglsqss ikyvaekadvylsgdlthhskilaeelglvvvdathystevfglkkfkeflssnldleii sldf
Timeline for d4iwma_: