SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4iw3k1 (4iw3 K:10-205)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (125 species)
    not a true protein
  7. 2114626Species Pseudomonas putida [TaxId:160488] [256311] (2 PDB entries)
  8. 2114633Domain d4iw3k1: 4iw3 K:10-205 [252735]
    Other proteins in same PDB: d4iw3a_, d4iw3b2, d4iw3b3, d4iw3j_, d4iw3k2, d4iw3k3
    automated match to d1b23p3
    complexed with gdp, mg, mn, oga

Details for d4iw3k1

PDB Entry: 4iw3 (more details), 2.7 Å

PDB Description: Crystal structure of a Pseudomonas putida prolyl-4-hydroxylase (P4H) in complex with elongation factor Tu (EF-Tu)
PDB Compounds: (K:) elongation factor tu-a

SCOPe Domain Sequences for d4iw3k1:

Sequence, based on SEQRES records: (download)

>d4iw3k1 c.37.1.0 (K:10-205) automated matches {Pseudomonas putida [TaxId: 160488]}
lphvnvgtighvdhgkttltaaltrvcsevfgsaivefdkidsapeekargitintahve
ynstirhyahvdcpghadyvknmitgaaqmdgailvcsaadgpmpqtrehillsrqvgvp
yivvflnkadlvddaellelvemevrdllstydfpgddtpiiigsarmalegkddnemgt
tavkklvetldsyipe

Sequence, based on observed residues (ATOM records): (download)

>d4iw3k1 c.37.1.0 (K:10-205) automated matches {Pseudomonas putida [TaxId: 160488]}
lphvnvgtighvdhgkttltaaltrvcsevfgkidsapeekagitintahveynstirhy
ahvdcpghadyvknmitgaaqmdgailvcsaadgpmpqtrehillsrqvgvpyivvflnk
adlvaellelvemevrdllstydfpgddtpiiigsarmalegkddnemgttavkklvetl
dsyipe

SCOPe Domain Coordinates for d4iw3k1:

Click to download the PDB-style file with coordinates for d4iw3k1.
(The format of our PDB-style files is described here.)

Timeline for d4iw3k1: