SCOPe 2.05: Domain d4ivzf_: 4ivz F:

Lineage for d4ivzf_ (4ivz F:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.0: automated matches [191534] (1 protein)
   not a true family

6. Protein automated matches [190907] (8 species)
   not a true protein

7. Species Enterobacter sp. [TaxId:211595] [189872] (13 PDB entries)

8. Domain d4ivzf_: 4ivz F: [252731]
   automated match to d4i6ua_
   protein/DNA complex; mutant

Details for d4ivzf_

PDB Entry: 4ivz, 3.1 Å

PDB Description: A Y37F mutant of C.Esp1396I bound to its highest affinity operator site OM

PDB Compounds: (F:) Regulatory protein

SCOPe Domain Sequences for d4ivzf_:

Sequence; same for both SEQRES and ATOM records:

>d4ivzf_ a.35.1.0 (F:) automated matches {Enterobacter sp. [TaxId: 211595]}
esfllskvsfvikkirlekgmtqedlayksnldrtfisgiernsrnltikslelimkgle
vsdvvffemlikeilk

Timeline for d4ivzf_:

• d4ivzf_ first appeared in SCOPe 2.04
  
• d4ivzf_ appears in SCOPe 2.06
  
• d4ivzf_ appears in the current release, SCOPe 2.08