Lineage for d1bdxd3 (1bdx D:1-64)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 14052Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 14088Family b.40.4.2: DNA helicase RuvA subunit, N-terminal domain [50259] (1 protein)
  6. 14089Protein DNA helicase RuvA subunit, N-terminal domain [50260] (2 species)
  7. 14090Species Escherichia coli [TaxId:562] [50261] (5 PDB entries)
  8. 14099Domain d1bdxd3: 1bdx D:1-64 [25273]
    Other proteins in same PDB: d1bdxa1, d1bdxa2, d1bdxb1, d1bdxb2, d1bdxc1, d1bdxc2, d1bdxd1, d1bdxd2

Details for d1bdxd3

PDB Entry: 1bdx (more details), 6 Å

PDB Description: e. coli dna helicase ruva with bound dna holliday junction, alpha carbons and phosphate atoms only
PDB Compounds: (D:) holliday junction DNA helicase ruva

SCOP Domain Sequences for d1bdxd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bdxd3 b.40.4.2 (D:1-64) DNA helicase RuvA subunit, N-terminal domain {Escherichia coli}
migrlrgiiiekqpplvlievggvgyevhmpmtcfyelpeagqeaivfthfvvredaqll
ygfn

SCOP Domain Coordinates for d1bdxd3:

Click to download the PDB-style file with coordinates for d1bdxd3.
(The format of our PDB-style files is described here.)

Timeline for d1bdxd3: