| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
| Family a.35.1.0: automated matches [191534] (1 protein) not a true family |
| Protein automated matches [190907] (21 species) not a true protein |
| Species Enterobacter sp. [TaxId:211595] [189872] (13 PDB entries) |
| Domain d4ivzb_: 4ivz B: [252729] automated match to d4i6ua_ protein/DNA complex; mutant |
PDB Entry: 4ivz (more details), 3.1 Å
SCOPe Domain Sequences for d4ivzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ivzb_ a.35.1.0 (B:) automated matches {Enterobacter sp. [TaxId: 211595]}
esfllskvsfvikkirlekgmtqedlayksnldrtfisgiernsrnltikslelimkgle
vsdvvffemlikeilk
Timeline for d4ivzb_: