SCOPe 2.07: Domain d4iuga5: 4iug A:846-1005

Lineage for d4iuga5 (4iug A:846-1005)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (49 species)
   not a true protein

7. Species Fungus (Aspergillus oryzae) [TaxId:5062] [256310] (3 PDB entries)

8. Domain d4iuga5: 4iug A:846-1005 [252724]
   Other proteins in same PDB: d4iuga1, d4iuga2, d4iuga3
   automated match to d1tg7a3
   complexed with cd, gal, m6d, nag

Details for d4iuga5

PDB Entry: 4iug, 2.6 Å

PDB Description: crystal structure of beta-galactosidase from aspergillus oryzae in complex with galactose

PDB Compounds: (A:) Beta-galactosidase A

SCOPe Domain Sequences for d4iuga5:

Sequence; same for both SEQRES and ATOM records:

>d4iuga5 b.18.1.0 (A:846-1005) automated matches {Fungus (Aspergillus oryzae) [TaxId: 5062]}
qdkvrgplnegglyaerqgfhqpqppseswesgspleglskpgigfytaqfdldlpkgwd
vplyfnfgnntqaaraqlyvngyqygkftgnvgpqtsfpvpegilnyrgtnyvalslwal
esdgaklgsfelsyttpvltgygnvespeqpkyeqrkgay

Timeline for d4iuga5:

• d4iuga5 first appeared in SCOPe 2.04
  
• d4iuga5 appears in SCOPe 2.06
  
• d4iuga5 appears in the current release, SCOPe 2.08