Lineage for d4iuga5 (4iug A:846-1005)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775223Species Fungus (Aspergillus oryzae) [TaxId:5062] [256310] (3 PDB entries)
  8. 2775229Domain d4iuga5: 4iug A:846-1005 [252724]
    Other proteins in same PDB: d4iuga1, d4iuga2, d4iuga3
    automated match to d1tg7a3
    complexed with cd, gal, nag

Details for d4iuga5

PDB Entry: 4iug (more details), 2.6 Å

PDB Description: crystal structure of beta-galactosidase from aspergillus oryzae in complex with galactose
PDB Compounds: (A:) Beta-galactosidase A

SCOPe Domain Sequences for d4iuga5:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iuga5 b.18.1.0 (A:846-1005) automated matches {Fungus (Aspergillus oryzae) [TaxId: 5062]}
qdkvrgplnegglyaerqgfhqpqppseswesgspleglskpgigfytaqfdldlpkgwd
vplyfnfgnntqaaraqlyvngyqygkftgnvgpqtsfpvpegilnyrgtnyvalslwal
esdgaklgsfelsyttpvltgygnvespeqpkyeqrkgay

SCOPe Domain Coordinates for d4iuga5:

Click to download the PDB-style file with coordinates for d4iuga5.
(The format of our PDB-style files is described here.)

Timeline for d4iuga5: