| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
| Protein automated matches [190770] (51 species) not a true protein |
| Species Fungus (Aspergillus oryzae) [TaxId:5062] [256310] (3 PDB entries) |
| Domain d4iuga4: 4iug A:664-845 [252723] Other proteins in same PDB: d4iuga1, d4iuga2, d4iuga3 automated match to d1tg7a2 complexed with cd, gal, nag |
PDB Entry: 4iug (more details), 2.6 Å
SCOPe Domain Sequences for d4iuga4:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iuga4 b.18.1.0 (A:664-845) automated matches {Fungus (Aspergillus oryzae) [TaxId: 5062]}
apeiklpglkdldwkyldtlpeikssyddsawvsadlpktknthrpldtptslyssdygf
htgyliyrghfvangkeseffirtqggsafgssvwlnetylgswtgadyamdgnstykls
qlesgknyvitvvidnlgldenwtvgeetmknprgilsyklsgqdasaitwkltgnlgge
dy
Timeline for d4iuga4:
View in 3DDomains from same chain: (mouse over for more information) d4iuga1, d4iuga2, d4iuga3, d4iuga5 |