Lineage for d4iuga1 (4iug A:40-393)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (90 species)
    not a true protein
  7. 2083938Species Fungus (Aspergillus oryzae) [TaxId:5062] [256307] (3 PDB entries)
  8. 2083939Domain d4iuga1: 4iug A:40-393 [252720]
    Other proteins in same PDB: d4iuga2, d4iuga3, d4iuga4, d4iuga5
    automated match to d1tg7a5
    complexed with cd, gal, m6d, nag

Details for d4iuga1

PDB Entry: 4iug (more details), 2.6 Å

PDB Description: Crystal structure of beta-galactosidase from Aspergillus oryzae in complex with galactose
PDB Compounds: (A:) Beta-galactosidase A

SCOPe Domain Sequences for d4iuga1:

Sequence, based on SEQRES records: (download)

>d4iuga1 c.1.8.0 (A:40-393) automated matches {Fungus (Aspergillus oryzae) [TaxId: 5062]}
dllqdivtwddkslfingerimlfsgevhpfrlpvpslwldifhkiralgfncvsfyidw
allegkpgdyraegifalepffdaakeagiyliarpgsyinaevsgggfpgwlqrvngtl
rssdepflkatdnyianaaaavakaqitnggpvilyqpeneysggccgvkypdadymqyv
mdqarkadivvpfisndaspsghnapgsgtgavdiyghdsyplgfdcanpsvwpegklpd
nfrtlhleqspstpysllefqagafdpwggpgfekcyalvnhefsrvfyrndlsfgvstf
nlymtfggtnwgnlghpggytsydygspitetrnvtrekysdikllanfvkasp

Sequence, based on observed residues (ATOM records): (download)

>d4iuga1 c.1.8.0 (A:40-393) automated matches {Fungus (Aspergillus oryzae) [TaxId: 5062]}
dllqdivtwddkslfingerimlfsgevhpfrlpvpslwldifhkiralgfncvsfyidw
allegkpgdyraegifalepffdaakeagiyliarpgsyinaevsgggfpgwlqrvngtl
rssdepflkatdnyianaaaavakaqitnggpvilyqpeneysdadymqyvmdqarkadi
vvpfisndaspsghnapgsgtgavdiyghdsyplgfdcanpsvwpegklpdnfrtlhleq
spstpysllefqagafdpwggpgfekcyalvnhefsrvfyrndlsfgvstfnlymtfggt
nwgnlghpggytsydygspitetrnvtrekysdikllanfvkasp

SCOPe Domain Coordinates for d4iuga1:

Click to download the PDB-style file with coordinates for d4iuga1.
(The format of our PDB-style files is described here.)

Timeline for d4iuga1: