SCOPe 2.07: Domain d4iuag1: 4iua G:38-127

Lineage for d4iuag1 (4iua G:38-127)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily)
   alpha+beta fold with two crossing loops

4. Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families)
   the middle part is structurally similar to some knottins and defensins but differs in the disulfide pattern

5. Family g.10.1.1: Hairpin loop containing domain [57415] (2 proteins)
   automatically mapped to Pfam PF00024

6. Protein automated matches [191160] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189357] (3 PDB entries)

8. Domain d4iuag1: 4iua G:38-127 [252714]
   Other proteins in same PDB: d4iuaa2, d4iuaa3, d4iuab2, d4iuab3, d4iuac2, d4iuac3, d4iuad2, d4iuad3, d4iuae2, d4iuae3, d4iuaf2, d4iuaf3, d4iuag2, d4iuag3, d4iuah2, d4iuah3
   automated match to d1bhta1
   complexed with epe, so4

Details for d4iuag1

PDB Entry: 4iua, 3.05 Å

PDB Description: crystal structure of the nk2 fragment (31-290) of the mouse hepatocyte growth factor/scatter factor

PDB Compounds: (G:) hepatocyte growth factor

SCOPe Domain Sequences for d4iuag1:

Sequence, based on SEQRES records:

>d4iuag1 g.10.1.1 (G:38-127) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ntlhefkksakttltkedpllkiktkkvnsadecanrcirnrgftftckafvfdksrkrc
ywypfnsmssgvkkgfghefdlyenkdyir

Sequence, based on observed residues (ATOM records):

>d4iuag1 g.10.1.1 (G:38-127) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ntlhefkksakttltkdpllkiktkkvnsadecanrctftckafvfdksrkrcywypfns
mssgvkkgfghefdlyenkdyir

Timeline for d4iuag1:

• d4iuag1 first appeared in SCOPe 2.04
  
• d4iuag1 appears in SCOPe 2.06
  
• d4iuag1 appears in the current release, SCOPe 2.08