![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily) alpha+beta fold with two crossing loops |
![]() | Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families) ![]() the middle part is structurally similar to some knottins and defensins but differs in the disulfide pattern |
![]() | Family g.10.1.1: Hairpin loop containing domain [57415] (2 proteins) automatically mapped to Pfam PF00024 |
![]() | Protein automated matches [191160] (2 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [189357] (3 PDB entries) |
![]() | Domain d4iuab1: 4iua B:37-127 [252699] Other proteins in same PDB: d4iuaa2, d4iuaa3, d4iuab2, d4iuab3, d4iuac2, d4iuac3, d4iuad2, d4iuad3, d4iuae2, d4iuae3, d4iuaf2, d4iuaf3, d4iuag2, d4iuag3, d4iuah2, d4iuah3 automated match to d1bhta1 complexed with epe, so4 |
PDB Entry: 4iua (more details), 3.05 Å
SCOPe Domain Sequences for d4iuab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iuab1 g.10.1.1 (B:37-127) automated matches {Mouse (Mus musculus) [TaxId: 10090]} rntlhefkksakttltkedpllkiktkkvnsadecanrcirnrgftftckafvfdksrkr cywypfnsmssgvkkgfghefdlyenkdyir
Timeline for d4iuab1: