SCOPe 2.05: Domain d4iuab1: 4iua B:37-127

Lineage for d4iuab1 (4iua B:37-127)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.10: Hairpin loop containing domain-like [57413] (1 superfamily)
   alpha+beta fold with two crossing loops

4. Superfamily g.10.1: Hairpin loop containing domain-like [57414] (3 families)
   the middle part is structurally similar to some knottins and defensins but differs in the disulfide pattern

5. Family g.10.1.1: Hairpin loop containing domain [57415] (2 proteins)
   automatically mapped to Pfam PF00024

6. Protein automated matches [191160] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189357] (3 PDB entries)

8. Domain d4iuab1: 4iua B:37-127 [252699]
   Other proteins in same PDB: d4iuaa2, d4iuaa3, d4iuab2, d4iuab3, d4iuac2, d4iuac3, d4iuad2, d4iuad3, d4iuae2, d4iuae3, d4iuaf2, d4iuaf3, d4iuag2, d4iuag3, d4iuah2, d4iuah3
   automated match to d1bhta1
   complexed with epe, so4

Details for d4iuab1

PDB Entry: 4iua, 3.05 Å

PDB Description: crystal structure of the nk2 fragment (31-290) of the mouse hepatocyte growth factor/scatter factor

PDB Compounds: (B:) hepatocyte growth factor

SCOPe Domain Sequences for d4iuab1:

Sequence; same for both SEQRES and ATOM records:

>d4iuab1 g.10.1.1 (B:37-127) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rntlhefkksakttltkedpllkiktkkvnsadecanrcirnrgftftckafvfdksrkr
cywypfnsmssgvkkgfghefdlyenkdyir

Timeline for d4iuab1:

• d4iuab1 first appeared in SCOPe 2.04
  
• d4iuab1 appears in SCOPe 2.06
  
• d4iuab1 appears in the current release, SCOPe 2.08