Lineage for d4is2a_ (4is2 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846592Species Clostridium scindens [TaxId:29347] [234900] (2 PDB entries)
  8. 2846593Domain d4is2a_: 4is2 A: [252691]
    automated match to d4is3a_
    complexed with cl

Details for d4is2a_

PDB Entry: 4is2 (more details), 1.9 Å

PDB Description: crystal structure of the apo form of a 3alpha-hydroxysteroid dehydrogenase (baia2) associated with secondary bile acid synthesis from clostridium scindens vpi12708 at 1.90 a resolution
PDB Compounds: (A:) Bile acid 3-alpha hydroxysteroid dehydrogenase

SCOPe Domain Sequences for d4is2a_:

Sequence, based on SEQRES records: (download)

>d4is2a_ c.2.1.0 (A:) automated matches {Clostridium scindens [TaxId: 29347]}
mnlvqdkvtiitggtrgigfaaakifidngakvsifgetqeevdtalaqlkelypeeevl
gfapdltsrdavmaavgqvaqkygrldvminnagitsnnvfsrvseeefkhimdinvtgv
fngawcayqcmkdakkgviintasvtgifgslsgvgypaskasviglthglgreiirkni
rvvgvapgvvntdmtngnppeimegylkalpmkrmlepeeianvylflasdlasgitatt
vsvdg

Sequence, based on observed residues (ATOM records): (download)

>d4is2a_ c.2.1.0 (A:) automated matches {Clostridium scindens [TaxId: 29347]}
mnlvqdkvtiitggtrgigfaaakifidngakvsifgetqeevdtalaqlkelypeeevl
gfapdltsrdavmaavgqvaqkygrldvminnagitsnnvfsrvseeefkhimdinvtgv
fngawcayqcmkdakkgviintasvtgifpaskasviglthglgreiirknirvvgvapg
vvntmlepeeianvylflasdlasgitattvsvdg

SCOPe Domain Coordinates for d4is2a_:

Click to download the PDB-style file with coordinates for d4is2a_.
(The format of our PDB-style files is described here.)

Timeline for d4is2a_: