Lineage for d1c7ya3 (1c7y A:1-64)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 14052Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 14088Family b.40.4.2: DNA helicase RuvA subunit, N-terminal domain [50259] (1 protein)
  6. 14089Protein DNA helicase RuvA subunit, N-terminal domain [50260] (2 species)
  7. 14090Species Escherichia coli [TaxId:562] [50261] (5 PDB entries)
  8. 14095Domain d1c7ya3: 1c7y A:1-64 [25269]
    Other proteins in same PDB: d1c7ya1, d1c7ya2

Details for d1c7ya3

PDB Entry: 1c7y (more details), 3.1 Å

PDB Description: e.coli ruva-holliday junction complex

SCOP Domain Sequences for d1c7ya3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c7ya3 b.40.4.2 (A:1-64) DNA helicase RuvA subunit, N-terminal domain {Escherichia coli}
migrlrgiiiekqpplvlievggvgyevhmpmtcfyelpeagqeaivfthfvvredaqll
ygfn

SCOP Domain Coordinates for d1c7ya3:

Click to download the PDB-style file with coordinates for d1c7ya3.
(The format of our PDB-style files is described here.)

Timeline for d1c7ya3: