Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries) |
Domain d4irjc2: 4irj C:116-204 [252688] Other proteins in same PDB: d4irja1, d4irja2, d4irjb_, d4irjc1, d4irjd1, d4irjd2 automated match to d2pyfa2 complexed with 1l9, nag |
PDB Entry: 4irj (more details), 3 Å
SCOPe Domain Sequences for d4irjc2:
Sequence, based on SEQRES records: (download)
>d4irjc2 b.1.1.2 (C:116-204) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffps
>d4irjc2 b.1.1.2 (C:116-204) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnkdfacanafnnsiipedtffps
Timeline for d4irjc2: