SCOPe 2.04: Domain d4iqwa1: 4iqw A:149-242

Lineage for d4iqwa1 (4iqw A:149-242)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.0: automated matches [254214] (1 protein)
   not a true family

6. Protein automated matches [254482] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [255236] (18 PDB entries)

8. Domain d4iqwa1: 4iqw A:149-242 [252681]
   Other proteins in same PDB: d4iqwa2, d4iqwa3
   automated match to d1jmsa1
   protein/DNA complex; complexed with 1fq, na

Details for d4iqwa1

PDB Entry: 4iqw, 2.6 Å

PDB Description: tdt core in complex with inhibitor (2z,5e)-6-[4-(4-fluorobenzoyl)-1h- pyrrol-2-yl]-2-hydroxy-4-oxohexa-2,5-dienoic acid and ssdna

PDB Compounds: (A:) DNA nucleotidylexotransferase

SCOPe Domain Sequences for d4iqwa1:

Sequence; same for both SEQRES and ATOM records:

>d4iqwa1 a.60.6.0 (A:149-242) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kisqyacqrrttlnnynqlftdaldilaendelrenegsclafmrassvlkslpfpitsm
kdtegipclgdkvksiiegiiedgesseakavln

Timeline for d4iqwa1:

• d4iqwa1 is new in SCOPe 2.04-stable
  
• d4iqwa1 appears in SCOPe 2.05
  
• d4iqwa1 appears in the current release, SCOPe 2.08