SCOPe 2.07: Domain d1d8lb2: 1d8l B:1-64

Lineage for d1d8lb2 (1d8l B:1-64)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.2: DNA helicase RuvA subunit, N-terminal domain [50259] (1 protein)
   barrel, closed; n=5, S=10
   automatically mapped to Pfam PF01330

6. Protein DNA helicase RuvA subunit, N-terminal domain [50260] (3 species)
   tetramer; binds Holliday junction

7. Species Escherichia coli [TaxId:562] [50261] (5 PDB entries)

8. Domain d1d8lb2: 1d8l B:1-64 [25268]
   Other proteins in same PDB: d1d8la1, d1d8lb1

Details for d1d8lb2

PDB Entry: 1d8l, 2.5 Å

PDB Description: e. coli holliday junction binding protein ruva nh2 region lacking domain iii

PDB Compounds: (B:) protein (holliday junction DNA helicase ruva)

SCOPe Domain Sequences for d1d8lb2:

Sequence; same for both SEQRES and ATOM records:

>d1d8lb2 b.40.4.2 (B:1-64) DNA helicase RuvA subunit, N-terminal domain {Escherichia coli [TaxId: 562]}
migrlrgiiiekqpplvlievggvgyevhmpmtcfyelpeagqeaivfthfvvredaqll
ygfn

Timeline for d1d8lb2:

• d1d8lb2 first appeared (with stable ids) in SCOP 1.55
  
• d1d8lb2 appears in SCOPe 2.06
  
• d1d8lb2 appears in the current release, SCOPe 2.08