Lineage for d1d8la2 (1d8l A:1-64)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789318Family b.40.4.2: DNA helicase RuvA subunit, N-terminal domain [50259] (1 protein)
    barrel, closed; n=5, S=10
    automatically mapped to Pfam PF01330
  6. 2789319Protein DNA helicase RuvA subunit, N-terminal domain [50260] (3 species)
    tetramer; binds Holliday junction
  7. 2789320Species Escherichia coli [TaxId:562] [50261] (5 PDB entries)
  8. 2789323Domain d1d8la2: 1d8l A:1-64 [25267]
    Other proteins in same PDB: d1d8la1, d1d8lb1

Details for d1d8la2

PDB Entry: 1d8l (more details), 2.5 Å

PDB Description: e. coli holliday junction binding protein ruva nh2 region lacking domain iii
PDB Compounds: (A:) protein (holliday junction DNA helicase ruva)

SCOPe Domain Sequences for d1d8la2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d8la2 b.40.4.2 (A:1-64) DNA helicase RuvA subunit, N-terminal domain {Escherichia coli [TaxId: 562]}
migrlrgiiiekqpplvlievggvgyevhmpmtcfyelpeagqeaivfthfvvredaqll
ygfn

SCOPe Domain Coordinates for d1d8la2:

Click to download the PDB-style file with coordinates for d1d8la2.
(The format of our PDB-style files is described here.)

Timeline for d1d8la2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d8la1