Lineage for d4inun_ (4inu N:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1934574Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1934686Protein Proteasome alpha subunit (non-catalytic) [56255] (7 species)
    contains an extension to the common fold at the N-terminus
  7. 1934702Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (76 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1935080Domain d4inun_: 4inu N: [252656]
    Other proteins in same PDB: d4inub_, d4inuc_, d4inuf_, d4inug_, d4inuh_, d4inup_, d4inuq_, d4inut_, d4inuu_, d4inuv_
    automated match to d4j70n_
    complexed with 1g6

Details for d4inun_

PDB Entry: 4inu (more details), 3.1 Å

PDB Description: Yeast 20S proteasome in complex with the vinyl sulfone LU112
PDB Compounds: (N:) Proteasome component PRE3

SCOPe Domain Sequences for d4inun_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4inun_ d.153.1.4 (N:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tsimavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivq
yhlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvh
klpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvlta
agverlifypdeyeql

SCOPe Domain Coordinates for d4inun_:

Click to download the PDB-style file with coordinates for d4inun_.
(The format of our PDB-style files is described here.)

Timeline for d4inun_: