Lineage for d1cuk_3 (1cuk 1-64)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296800Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 297373Superfamily b.40.4: Nucleic acid-binding proteins [50249] (11 families) (S)
  5. 297416Family b.40.4.2: DNA helicase RuvA subunit, N-terminal domain [50259] (1 protein)
    barrel, closed; n=5, S=10
  6. 297417Protein DNA helicase RuvA subunit, N-terminal domain [50260] (3 species)
    tetramer; binds Holliday junction
  7. 297418Species Escherichia coli [TaxId:562] [50261] (5 PDB entries)
  8. 297419Domain d1cuk_3: 1cuk 1-64 [25265]
    Other proteins in same PDB: d1cuk_1, d1cuk_2

Details for d1cuk_3

PDB Entry: 1cuk (more details), 1.9 Å

PDB Description: escherichia coli ruva protein at ph 4.9 and room temperature

SCOP Domain Sequences for d1cuk_3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cuk_3 b.40.4.2 (1-64) DNA helicase RuvA subunit, N-terminal domain {Escherichia coli}
migrlrgiiiekqpplvlievggvgyevhmpmtcfyelpeagqeaivfthfvvredaqll
ygfn

SCOP Domain Coordinates for d1cuk_3:

Click to download the PDB-style file with coordinates for d1cuk_3.
(The format of our PDB-style files is described here.)

Timeline for d1cuk_3: