Lineage for d4il8a2 (4il8 A:155-258)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910122Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. 2910123Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) (S)
  5. 2910221Family c.84.1.0: automated matches [254314] (1 protein)
    not a true family
  6. 2910222Protein automated matches [254721] (4 species)
    not a true protein
  7. 2910310Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [256304] (2 PDB entries)
  8. 2910315Domain d4il8a2: 4il8 A:155-258 [252641]
    Other proteins in same PDB: d4il8a4
    automated match to d1p5dx2
    complexed with gol, mg; mutant

Details for d4il8a2

PDB Entry: 4il8 (more details), 1.8 Å

PDB Description: crystal structure of an h329a mutant of p. aeruginosa pmm/pgm
PDB Compounds: (A:) Phosphomannomutase/phosphoglucomutase

SCOPe Domain Sequences for d4il8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4il8a2 c.84.1.0 (A:155-258) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
ilpryfkqirddiamakpmkvvvdcgngvagviapqliealgcsviplycevdgnfpnhh
pdpgkpenlkdliakvkaenadlglafdgdgdrvgvvtntgtii

SCOPe Domain Coordinates for d4il8a2:

Click to download the PDB-style file with coordinates for d4il8a2.
(The format of our PDB-style files is described here.)

Timeline for d4il8a2: