Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily) consists of three similar domains with 3 layers (a/b/a) each; duplication core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest |
Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) |
Family c.84.1.0: automated matches [254314] (1 protein) not a true family |
Protein automated matches [254721] (3 species) not a true protein |
Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [256304] (2 PDB entries) |
Domain d4il8a1: 4il8 A:5-154 [252640] Other proteins in same PDB: d4il8a4 automated match to d1k2yx1 complexed with gol, mg; mutant |
PDB Entry: 4il8 (more details), 1.8 Å
SCOPe Domain Sequences for d4il8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4il8a1 c.84.1.0 (A:5-154) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} kaptlpasifraydirgvvgdtltaetaywigraigseslargepcvavgrdgrlsgpel vkqliqglvdcgcqvsdvgmvptpvlyyaanvlegksgvmltgshnppdyngfkivvage tlaneqiqalreriekndlasgvgsveqvd
Timeline for d4il8a1: