Lineage for d1e1ta1 (1e1t A:11-153)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1314543Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1314544Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)
    barrel, closed; n=5, S=10
  6. 1314572Protein Lysyl-tRNA synthetase (LysRS) [50256] (3 species)
  7. 1314578Species Escherichia coli, gene lysU [TaxId:562] [50258] (5 PDB entries)
  8. 1314585Domain d1e1ta1: 1e1t A:11-153 [25264]
    Other proteins in same PDB: d1e1ta2
    protein/RNA complex; complexed with gol, lad, mg, pop

Details for d1e1ta1

PDB Entry: 1e1t (more details), 2.4 Å

PDB Description: lysyl-trna synthetase (lysu) hexagonal form complexed with the lysyl_adenylate intermediate
PDB Compounds: (A:) lysyl-tRNA synthetase, heat inducible

SCOPe Domain Sequences for d1e1ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e1ta1 b.40.4.1 (A:11-153) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU [TaxId: 562]}
aidfndelrnrreklaalrqqgvafpndfrrdhtsdqlheefdakdnqeleslnievsva
grmmtrrimgkasfvtlqdvggriqlyvardslpegvyndqfkkwdlgdiigargtlfkt
qtgelsihctelrlltkalrplp

SCOPe Domain Coordinates for d1e1ta1:

Click to download the PDB-style file with coordinates for d1e1ta1.
(The format of our PDB-style files is described here.)

Timeline for d1e1ta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e1ta2