![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
![]() | Protein automated matches [226922] (95 species) not a true protein |
![]() | Species Escherichia coli [TaxId:511145] [256302] (1 PDB entry) |
![]() | Domain d4il0h1: 4il0 H:6-136 [252638] Other proteins in same PDB: d4il0a2, d4il0b2, d4il0c2, d4il0d2, d4il0e2, d4il0f2, d4il0g2, d4il0h2 automated match to d3n6ha1 complexed with cit, gol |
PDB Entry: 4il0 (more details), 2.8 Å
SCOPe Domain Sequences for d4il0h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4il0h1 d.54.1.0 (H:6-136) automated matches {Escherichia coli [TaxId: 511145]} spvitdmkvipvaghdsmllniggahnayftrnivvltdnaghtgigeapggdviyqtlv daipmvlgqevarlnkvvqqvhkgnqaadfdtfgkgawtfelrvnavaaleaalldllgk alnvpvcellg
Timeline for d4il0h1: