SCOPe 2.08: Domain d4il0g1: 4il0 G:7-136

Lineage for d4il0g1 (4il0 G:7-136)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Escherichia coli [TaxId:511145] [256302] (1 PDB entry)

8. Domain d4il0g1: 4il0 G:7-136 [252636]
   Other proteins in same PDB: d4il0a2, d4il0b2, d4il0c2, d4il0d2, d4il0e2, d4il0f2, d4il0g2, d4il0h2
   automated match to d3n6ha1
   complexed with cit, gol

Details for d4il0g1

PDB Entry: 4il0, 2.8 Å

PDB Description: Crystal structure of GlucDRP from E. coli K-12 MG1655 (EFI target EFI-506058)

PDB Compounds: (G:) Glucarate dehydratase-related protein

SCOPe Domain Sequences for d4il0g1:

Sequence, based on SEQRES records:

>d4il0g1 d.54.1.0 (G:7-136) automated matches {Escherichia coli [TaxId: 511145]}
pvitdmkvipvaghdsmllniggahnayftrnivvltdnaghtgigeapggdviyqtlvd
aipmvlgqevarlnkvvqqvhkgnqaadfdtfgkgawtfelrvnavaaleaalldllgka
lnvpvcellg

Sequence, based on observed residues (ATOM records):

>d4il0g1 d.54.1.0 (G:7-136) automated matches {Escherichia coli [TaxId: 511145]}
pvitdmkvipvaghdsmllniggahnayftrnivvltdnaghtgigeapggdviyqtlvd
aipmvlgqevarlnkvvqqvhvnavaaleaalldllgkalnvpvcellg

Timeline for d4il0g1:

• d4il0g1 first appeared in SCOPe 2.04
  
• d4il0g1 appears in SCOPe 2.07