Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (88 species) not a true protein |
Species Escherichia coli [TaxId:511145] [256302] (1 PDB entry) |
Domain d4il0f1: 4il0 F:7-136 [252634] Other proteins in same PDB: d4il0a2, d4il0b2, d4il0c2, d4il0d2, d4il0e2, d4il0f2, d4il0g2, d4il0h2 automated match to d3n6ha1 complexed with cit, gol |
PDB Entry: 4il0 (more details), 2.8 Å
SCOPe Domain Sequences for d4il0f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4il0f1 d.54.1.0 (F:7-136) automated matches {Escherichia coli [TaxId: 511145]} pvitdmkvipvaghdsmllniggahnayftrnivvltdnaghtgigeapggdviyqtlvd aipmvlgqevarlnkvvqqvhkgnqaadfdtfgkgawtfelrvnavaaleaalldllgka lnvpvcellg
Timeline for d4il0f1: