Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (59 species) not a true protein |
Species Escherichia coli [TaxId:511145] [256303] (1 PDB entry) |
Domain d4il0e2: 4il0 E:137-445 [252633] Other proteins in same PDB: d4il0a1, d4il0b1, d4il0c1, d4il0d1, d4il0e1, d4il0f1, d4il0g1, d4il0h1 automated match to d3n6ha2 complexed with cit, gol |
PDB Entry: 4il0 (more details), 2.8 Å
SCOPe Domain Sequences for d4il0e2:
Sequence, based on SEQRES records: (download)
>d4il0e2 c.1.11.0 (E:137-445) automated matches {Escherichia coli [TaxId: 511145]} pgkqreaitvlgylfyigdrtktdlpyventpgnhewyqlrhqkamnseavvrlaeasqd rygfkdfklkggvlpgeqeidtvralkkrfpdaritvdpngawlldeaislckglndvlt yaedpcgaeqgfsgrevmaefrratglpvatnmiatnwremghavmlnavdipladphfw tlsgavrvaqlcddwgltwgchsnnhfdislamfthvgaaapgnptaidthwiwqegdcr ltqnpleikngkiavpdapglgveldweqvqkaheaykrlpggarndagpmqylipgwtf drkrpvfgr
>d4il0e2 c.1.11.0 (E:137-445) automated matches {Escherichia coli [TaxId: 511145]} pgkqreaitvlgylfyigdrtktdlpyventpgnhewyqlrhqkamnseavvrlaeasqd rygfkdfklkggvlpgeqeidtvralkkrfpdaritvdpngawlldeaislckglndvlt yaedpcgaeqgfsgrevmaefrratglpvatnmiatnwremghavmlnavdipladphfw tlsgavrvaqlcddwgltwgchsnnhfdislamfthvgaaapgnptaidthwiwqegdcr ltqnpleikngkiavpdapglgveldweqvqkaheaykrlpndagpmqylipgwtfdrkr pvfgr
Timeline for d4il0e2: