SCOPe 2.07: Domain d1lylc1: 1lyl C:14-153

Lineage for d1lylc1 (1lyl C:14-153)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)
   barrel, closed; n=5, S=10

6. Protein Lysyl-tRNA synthetase (LysRS) [50256] (3 species)

7. Species Escherichia coli, gene lysU [TaxId:562] [50258] (5 PDB entries)

8. Domain d1lylc1: 1lyl C:14-153 [25263]
   Other proteins in same PDB: d1lyla2, d1lylb2, d1lylc2
   protein/RNA complex; complexed with lys

Details for d1lylc1

PDB Entry: 1lyl, 2.8 Å

PDB Description: lysyl-trna synthetase (lysu) (e.c.6.1.1.6) complexed with lysine

PDB Compounds: (C:) lysyl-tRNA synthetase (lysu)

SCOPe Domain Sequences for d1lylc1:

Sequence; same for both SEQRES and ATOM records:

>d1lylc1 b.40.4.1 (C:14-153) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU [TaxId: 562]}
fndelrnrreklaalrqqgvafpndfrrdhtsdqlheefdakdnqeleslnievsvagrm
mtrrimgkasfvtlqdvggriqlyvardslpegvyndqfkkwdlgdiigargtlfktqtg
elsihctelrlltkalrplp

Timeline for d1lylc1:

• d1lylc1 first appeared (with stable ids) in SCOP 1.55
  
• d1lylc1 appears in SCOPe 2.06
  
• d1lylc1 appears in the current release, SCOPe 2.08