Lineage for d4ig9a1 (4ig9 A:234-501)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2121033Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2121034Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2121434Family c.31.1.0: automated matches [191352] (1 protein)
    not a true family
  6. 2121435Protein automated matches [190312] (11 species)
    not a true protein
  7. 2121454Species Human (Homo sapiens) [TaxId:9606] [224883] (17 PDB entries)
  8. 2121484Domain d4ig9a1: 4ig9 A:234-501 [252619]
    Other proteins in same PDB: d4ig9a2, d4ig9c2, d4ig9e2, d4ig9g2
    automated match to d1ma3a_
    complexed with zn

Details for d4ig9a1

PDB Entry: 4ig9 (more details), 2.64 Å

PDB Description: Structure of NAD-dependent protein deacetylase sirtuin-1 (open state, 2.64 A)
PDB Compounds: (A:) NAD-dependent protein deacetylase sirtuin-1

SCOPe Domain Sequences for d4ig9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ig9a1 c.31.1.0 (A:234-501) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rkkrkdintiedavkllqeckkiivltgagvsvscgipdfrsrdgiyarlavdfpdlpdp
qamfdieyfrkdprpffkfakeiypgqfqpslchkfialsdkegkllrnytqnidtleqv
agiqriiqchgsfatasclickykvdceavrgdifnqvvprcprcpadeplaimkpeivf
fgenlpeqfhramkydkdevdllivigsslkvrpvalipssiphevpqilinreplphlh
fdvellgdcdviinelchrlggeyaklc

SCOPe Domain Coordinates for d4ig9a1:

Click to download the PDB-style file with coordinates for d4ig9a1.
(The format of our PDB-style files is described here.)

Timeline for d4ig9a1: