| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
| Family c.31.1.0: automated matches [191352] (1 protein) not a true family |
| Protein automated matches [190312] (11 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [224883] (17 PDB entries) |
| Domain d4ig9a1: 4ig9 A:234-501 [252619] Other proteins in same PDB: d4ig9a2, d4ig9c2, d4ig9e2, d4ig9g2 automated match to d1ma3a_ complexed with zn |
PDB Entry: 4ig9 (more details), 2.64 Å
SCOPe Domain Sequences for d4ig9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ig9a1 c.31.1.0 (A:234-501) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rkkrkdintiedavkllqeckkiivltgagvsvscgipdfrsrdgiyarlavdfpdlpdp
qamfdieyfrkdprpffkfakeiypgqfqpslchkfialsdkegkllrnytqnidtleqv
agiqriiqchgsfatasclickykvdceavrgdifnqvvprcprcpadeplaimkpeivf
fgenlpeqfhramkydkdevdllivigsslkvrpvalipssiphevpqilinreplphlh
fdvellgdcdviinelchrlggeyaklc
Timeline for d4ig9a1: