SCOPe 2.05: Domain d4ig6a_: 4ig6 A:

Lineage for d4ig6a_ (4ig6 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.116: alpha/beta knot [75216] (1 superfamily)
   core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot

4. Superfamily c.116.1: alpha/beta knot [75217] (9 families)
   known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
   all known members have dimeric structures

5. Family c.116.1.0: automated matches [191557] (1 protein)
   not a true family

6. Protein automated matches [190961] (13 species)
   not a true protein

7. Species Anaplasma phagocytophilum [TaxId:212042] [232723] (2 PDB entries)

8. Domain d4ig6a_: 4ig6 A: [252618]
   automated match to d3knub_
   protein/RNA complex; complexed with cl, sah

Details for d4ig6a_

PDB Entry: 4ig6, 2.4 Å

PDB Description: Crystal structure of a tRNA (guanine-N1)-methyltransferase from Anaplasma phagocytophilum bound to S-adenosylhomocysteine

PDB Compounds: (A:) tRNA (guanine-N(1)-)-methyltransferase

SCOPe Domain Sequences for d4ig6a_:

Sequence; same for both SEQRES and ATOM records:

>d4ig6a_ c.116.1.0 (A:) automated matches {Anaplasma phagocytophilum [TaxId: 212042]}
smifnvltifpqmfpgplgvsnlgsalkkglwtlnvfdirafannkhntvddtpygggpg
mllradvlgrcidevlslhpntklmftsprgvsftqdiarqtmnfdnitllcgrfegide
rvvdfyklqevsigdyvlsggelaamviidtcvrmvpgvignaeslkqesmegsleypqy
trpaswkgmevpevlltgnhgeiekwrrnaslsitaarrpdll

Timeline for d4ig6a_:

• d4ig6a_ first appeared in SCOPe 2.04
  
• d4ig6a_ is called d4ig6a1 in SCOPe 2.06
  
• d4ig6a_ appears in the current release, SCOPe 2.08, called d4ig6a1