SCOPe 2.04: Domain d4iffd_: 4iff D:

Lineage for d4iffd_ (4iff D:)

1. Root: SCOPe 2.04

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.24: Head morphogenesis protein gp7 [90246] (1 family)

5. Family h.1.24.1: Head morphogenesis protein gp7 [90247] (2 proteins)

6. Protein automated matches [254750] (1 species)
   not a true protein

7. Species Bacillus phage [TaxId:10756] [256300] (1 PDB entry)

8. Domain d4iffd_: 4iff D: [252617]
   automated match to d1no4b_
   complexed with gol

Details for d4iffd_

PDB Entry: 4iff, 2.3 Å

PDB Description: structural organization of ftsb, a transmembrane protein of the bacterial divisome

PDB Compounds: (D:) Fusion of phage phi29 Gp7 protein and Cell division protein FtsB

SCOPe Domain Sequences for d4iffd_:

Sequence; same for both SEQRES and ATOM records:

>d4iffd_ h.1.24.1 (D:) automated matches {Bacillus phage [TaxId: 10756]}
gplkpeehedilnklldpelaqsertealqqlrvnygsfvseyndltkdytrvnddvaaq
qatnaklkarndqlfaeiddl

Timeline for d4iffd_:

• d4iffd_ is new in SCOPe 2.04-stable
  
• d4iffd_ appears in SCOPe 2.05
  
• d4iffd_ appears in the current release, SCOPe 2.08, called d4iffd1