SCOPe 2.07: Domain d4iffb1: 4iff B:2-160

Lineage for d4iffb1 (4iff B:2-160)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.24: Head morphogenesis protein gp7 [90246] (1 family)

5. Family h.1.24.1: Head morphogenesis protein gp7 [90247] (2 proteins)

6. Protein automated matches [254750] (1 species)
   not a true protein

7. Species Bacillus phage [TaxId:10756] [256300] (2 PDB entries)

8. Domain d4iffb1: 4iff B:2-160 [252615]
   Other proteins in same PDB: d4iffa2, d4iffb2, d4iffc2, d4iffd2
   automated match to d1no4b_
   complexed with gol

Details for d4iffb1

PDB Entry: 4iff, 2.3 Å

PDB Description: structural organization of ftsb, a transmembrane protein of the bacterial divisome

PDB Compounds: (B:) Fusion of phage phi29 Gp7 protein and Cell division protein FtsB

SCOPe Domain Sequences for d4iffb1:

Sequence; same for both SEQRES and ATOM records:

>d4iffb1 h.1.24.1 (B:2-160) automated matches {Bacillus phage [TaxId: 10756]}
plkpeehedilnklldpelaqsertealqqlrvnygsfvseyndltkdytrvnddvaaqq
atnaklkarndqlfaeiddl

Timeline for d4iffb1:

• d4iffb1 first appeared in SCOPe 2.04, called d4iffb_
  
• d4iffb1 appears in SCOPe 2.06
  
• d4iffb1 appears in the current release, SCOPe 2.08