Lineage for d4iffa1 (4iff A:2-160)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2643821Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2645079Superfamily h.1.24: Head morphogenesis protein gp7 [90246] (1 family) (S)
  5. 2645080Family h.1.24.1: Head morphogenesis protein gp7 [90247] (2 proteins)
  6. 2645091Protein automated matches [254750] (1 species)
    not a true protein
  7. 2645092Species Bacillus phage [TaxId:10756] [256300] (2 PDB entries)
  8. 2645095Domain d4iffa1: 4iff A:2-160 [252614]
    Other proteins in same PDB: d4iffa2, d4iffb2, d4iffc2, d4iffd2
    automated match to d1no4b_
    complexed with gol

Details for d4iffa1

PDB Entry: 4iff (more details), 2.3 Å

PDB Description: structural organization of ftsb, a transmembrane protein of the bacterial divisome
PDB Compounds: (A:) Fusion of phage phi29 Gp7 protein and Cell division protein FtsB

SCOPe Domain Sequences for d4iffa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iffa1 h.1.24.1 (A:2-160) automated matches {Bacillus phage [TaxId: 10756]}
plkpeehedilnklldpelaqsertealqqlrvnygsfvseyndltkdytrvnddvaaqq
atnaklkarndqlfaeiddl

SCOPe Domain Coordinates for d4iffa1:

Click to download the PDB-style file with coordinates for d4iffa1.
(The format of our PDB-style files is described here.)

Timeline for d4iffa1: