| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.1: Parallel coiled-coil [57943] (35 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.24: Head morphogenesis protein gp7 [90246] (1 family) ![]() |
| Family h.1.24.1: Head morphogenesis protein gp7 [90247] (2 proteins) |
| Protein automated matches [254750] (1 species) not a true protein |
| Species Bacillus phage [TaxId:10756] [256300] (2 PDB entries) |
| Domain d4iffa_: 4iff A: [252614] automated match to d1no4b_ complexed with gol |
PDB Entry: 4iff (more details), 2.3 Å
SCOPe Domain Sequences for d4iffa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iffa_ h.1.24.1 (A:) automated matches {Bacillus phage [TaxId: 10756]}
gplkpeehedilnklldpelaqsertealqqlrvnygsfvseyndltkdytrvnddvaaq
qatnaklkarndqlfaeiddl
Timeline for d4iffa_: