Lineage for d1lyla1 (1lyl A:14-153)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 14052Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 14053Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)
  6. 14074Protein Lysyl-tRNA synthetase (LysRS) [50256] (2 species)
  7. 14080Species Escherichia coli, gene lysU [TaxId:562] [50258] (5 PDB entries)
  8. 14084Domain d1lyla1: 1lyl A:14-153 [25261]
    Other proteins in same PDB: d1lyla2, d1lylb2, d1lylc2

Details for d1lyla1

PDB Entry: 1lyl (more details), 2.8 Å

PDB Description: lysyl-trna synthetase (lysu) (e.c.6.1.1.6) complexed with lysine

SCOP Domain Sequences for d1lyla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lyla1 b.40.4.1 (A:14-153) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU}
fndelrnrreklaalrqqgvafpndfrrdhtsdqlheefdakdnqeleslnievsvagrm
mtrrimgkasfvtlqdvggriqlyvardslpegvyndqfkkwdlgdiigargtlfktqtg
elsihctelrlltkalrplp

SCOP Domain Coordinates for d1lyla1:

Click to download the PDB-style file with coordinates for d1lyla1.
(The format of our PDB-style files is described here.)

Timeline for d1lyla1: