Class b: All beta proteins [48724] (176 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
Protein automated matches [190438] (19 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [256299] (1 PDB entry) |
Domain d4ic5a_: 4ic5 A: [252606] automated match to d3stia_ complexed with ca |
PDB Entry: 4ic5 (more details), 2.61 Å
SCOPe Domain Sequences for d4ic5a_:
Sequence, based on SEQRES records: (download)
>d4ic5a_ b.47.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} eeleeeeernvnlfqktspsvvyieaielpktssgdiltdeengkiegtgsgfvwdklgh ivtnyhviaklatdqfglqrckvslvdakgtrfskegkivgldpdndlavlkietegrel npvvlgtsndlrvgqscfaignpygyentltigvvsglgreipspngksiseaiqtdadi nsgnaggplldsyghtigvntatftrkgsgmssgvnfaipidtvvrtvpylivygta
>d4ic5a_ b.47.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} eeleeeeernvnlfqktspsvvyieaielegtgsgfvwdklghivtnyhviaklatdqfg lqrckvslvdakgtrfskegkivgldpdndlavlkietegrelnpvvlgtsndlrvgqsc faignpygyentltigvvsglgreipspngksiseaiqtdadinsgnaggplldsyghti gvntatfvnfaipidtvvrtvpylivygta
Timeline for d4ic5a_: