Lineage for d4ic5a_ (4ic5 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1545310Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1545311Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1547699Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 1547700Protein automated matches [190438] (19 species)
    not a true protein
  7. 1547856Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [256299] (1 PDB entry)
  8. 1547857Domain d4ic5a_: 4ic5 A: [252606]
    automated match to d3stia_
    complexed with ca

Details for d4ic5a_

PDB Entry: 4ic5 (more details), 2.61 Å

PDB Description: Crystal structure of Deg5
PDB Compounds: (A:) Protease Do-like 5, chloroplastic

SCOPe Domain Sequences for d4ic5a_:

Sequence, based on SEQRES records: (download)

>d4ic5a_ b.47.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
eeleeeeernvnlfqktspsvvyieaielpktssgdiltdeengkiegtgsgfvwdklgh
ivtnyhviaklatdqfglqrckvslvdakgtrfskegkivgldpdndlavlkietegrel
npvvlgtsndlrvgqscfaignpygyentltigvvsglgreipspngksiseaiqtdadi
nsgnaggplldsyghtigvntatftrkgsgmssgvnfaipidtvvrtvpylivygta

Sequence, based on observed residues (ATOM records): (download)

>d4ic5a_ b.47.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
eeleeeeernvnlfqktspsvvyieaielegtgsgfvwdklghivtnyhviaklatdqfg
lqrckvslvdakgtrfskegkivgldpdndlavlkietegrelnpvvlgtsndlrvgqsc
faignpygyentltigvvsglgreipspngksiseaiqtdadinsgnaggplldsyghti
gvntatfvnfaipidtvvrtvpylivygta

SCOPe Domain Coordinates for d4ic5a_:

Click to download the PDB-style file with coordinates for d4ic5a_.
(The format of our PDB-style files is described here.)

Timeline for d4ic5a_: