| Class b: All beta proteins [48724] (180 folds) |
| Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key duplication: has internal pseudo twofold symmetry |
Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) ![]() |
| Family b.11.1.0: automated matches [191607] (1 protein) not a true family |
| Protein automated matches [191109] (11 species) not a true protein |
| Species Geodia cydonium [TaxId:6047] [256298] (1 PDB entry) |
| Domain d4iaua_: 4iau A: [252605] automated match to d4jgfb_ complexed with ca, gol |
PDB Entry: 4iau (more details), 0.99 Å
SCOPe Domain Sequences for d4iaua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iaua_ b.11.1.0 (A:) automated matches {Geodia cydonium [TaxId: 6047]}
stakvtlvtsggssqdftseqtnittdfarvrvtkgmwifyqqanyndasgggslwikld
esshlmdlpftprsfrpvktfqvgatlykhvnfggkeldlpnsnpridiggvssalisqg
qwrlyeqydyagpstrrgpgvyvnagalgvandalksmere
Timeline for d4iaua_: