Lineage for d4iaua_ (4iau A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773464Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2773465Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2773616Family b.11.1.0: automated matches [191607] (1 protein)
    not a true family
  6. 2773617Protein automated matches [191109] (11 species)
    not a true protein
  7. 2773662Species Geodia cydonium [TaxId:6047] [256298] (1 PDB entry)
  8. 2773663Domain d4iaua_: 4iau A: [252605]
    automated match to d4jgfb_
    complexed with ca, gol

Details for d4iaua_

PDB Entry: 4iau (more details), 0.99 Å

PDB Description: Atomic resolution structure of Geodin, a beta-gamma crystallin from Geodia cydonium
PDB Compounds: (A:) Beta-gamma-crystallin

SCOPe Domain Sequences for d4iaua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iaua_ b.11.1.0 (A:) automated matches {Geodia cydonium [TaxId: 6047]}
stakvtlvtsggssqdftseqtnittdfarvrvtkgmwifyqqanyndasgggslwikld
esshlmdlpftprsfrpvktfqvgatlykhvnfggkeldlpnsnpridiggvssalisqg
qwrlyeqydyagpstrrgpgvyvnagalgvandalksmere

SCOPe Domain Coordinates for d4iaua_:

Click to download the PDB-style file with coordinates for d4iaua_.
(The format of our PDB-style files is described here.)

Timeline for d4iaua_: