Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.19: Aquaporin-like [81339] (1 superfamily) core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices |
Superfamily f.19.1: Aquaporin-like [81338] (2 families) |
Family f.19.1.0: automated matches [191436] (1 protein) not a true family |
Protein automated matches [190629] (7 species) not a true protein |
Species Spinach (Spinacia oleracea) [TaxId:3562] [255773] (6 PDB entries) |
Domain d4ia4a_: 4ia4 A: [252601] automated match to d3m9ia_ complexed with hg |
PDB Entry: 4ia4 (more details), 3.1 Å
SCOPe Domain Sequences for d4ia4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ia4a_ f.19.1.0 (A:) automated matches {Spinach (Spinacia oleracea) [TaxId: 3562]} pffdlgelklwsfwraaiaefiatllflyitvatvighsketvvcgsvgllgiawafggm ifvlvyctagisgghinpavtfglflarkvsllralvymiaqclgaicgvglvkafmkgp ynqfgggansvalgynkgtalgaeiigtfvlvytvfsatdpkrsardshvpilaplpigf avfmvhlatipitgtginparsfgaavifnsnkvwddqwifwvgpfigaavaaayhqyvl raa
Timeline for d4ia4a_: