Lineage for d1e24a1 (1e24 A:11-153)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 166216Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 166762Superfamily b.40.4: Nucleic acid-binding proteins [50249] (10 families) (S)
  5. 166763Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)
  6. 166788Protein Lysyl-tRNA synthetase (LysRS) [50256] (2 species)
  7. 166794Species Escherichia coli, gene lysU [TaxId:562] [50258] (5 PDB entries)
  8. 166797Domain d1e24a1: 1e24 A:11-153 [25260]
    Other proteins in same PDB: d1e24a2

Details for d1e24a1

PDB Entry: 1e24 (more details), 2.35 Å

PDB Description: lysyl-trna synthetase (lysu) hexagonal form complexed with lysine and atp and mn2+

SCOP Domain Sequences for d1e24a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e24a1 b.40.4.1 (A:11-153) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU}
aidfndelrnrreklaalrqqgvafpndfrrdhtsdqlheefdakdnqeleslnievsva
grmmtrrimgkasfvtlqdvggriqlyvardslpegvyndqfkkwdlgdiigargtlfkt
qtgelsihctelrlltkalrplp

SCOP Domain Coordinates for d1e24a1:

Click to download the PDB-style file with coordinates for d1e24a1.
(The format of our PDB-style files is described here.)

Timeline for d1e24a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e24a2