Lineage for d4i78c1 (4i78 C:6-174)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2266924Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2266925Protein Influenza hemagglutinin (stalk) [58066] (12 species)
    trimer
  7. 2266962Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)
  8. 2267172Domain d4i78c1: 4i78 C:6-174 [252591]
    Other proteins in same PDB: d4i78a_, d4i78b_, d4i78c2, d4i78d2
    automated match to d4n5zb_
    complexed with nag

Details for d4i78c1

PDB Entry: 4i78 (more details), 3.18 Å

PDB Description: Crystal structure of a subtype H17 hemagglutinin homologue from A/little yellow-shouldered bat/Guatemala/060/2010 (H17N10)
PDB Compounds: (C:) hemagglutinin HA2

SCOPe Domain Sequences for d4i78c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i78c1 h.3.1.1 (C:6-174) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
iagfieggwqgmidgwygyhhenqegsgyaadkeatqkavdgitnkvnsiidkmnsqfes
nikefnrlelriqhlsdrvddalldiwsyntellvllenertldfhdanvknlfekvkaq
lkdnaidegngcflllhkcnnscmddikngtykymdyreeshiekqkid

SCOPe Domain Coordinates for d4i78c1:

Click to download the PDB-style file with coordinates for d4i78c1.
(The format of our PDB-style files is described here.)

Timeline for d4i78c1: