SCOPe 2.05: Domain d4i78c_: 4i78 C:

Lineage for d4i78c_ (4i78 C:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (8 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (109 PDB entries)

8. Domain d4i78c_: 4i78 C: [252591]
   Other proteins in same PDB: d4i78a_, d4i78b_
   automated match to d4n5zb_
   complexed with nag

Details for d4i78c_

PDB Entry: 4i78, 3.18 Å

PDB Description: crystal structure of a subtype h17 hemagglutinin homologue from a/little yellow-shouldered bat/guatemala/060/2010 (h17n10)

PDB Compounds: (C:) hemagglutinin HA2

SCOPe Domain Sequences for d4i78c_:

Sequence; same for both SEQRES and ATOM records:

>d4i78c_ h.3.1.1 (C:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
iagfieggwqgmidgwygyhhenqegsgyaadkeatqkavdgitnkvnsiidkmnsqfes
nikefnrlelriqhlsdrvddalldiwsyntellvllenertldfhdanvknlfekvkaq
lkdnaidegngcflllhkcnnscmddikngtykymdyreeshiekqkids

Timeline for d4i78c_:

• d4i78c_ first appeared in SCOPe 2.04
  
• d4i78c_ is called d4i78c1 in SCOPe 2.06
  
• d4i78c_ appears in the current release, SCOPe 2.08, called d4i78c1