Lineage for d4i78c_ (4i78 C:)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1709414Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1709415Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1709416Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1709417Protein Influenza hemagglutinin (stalk) [58066] (7 species)
    trimer
  7. 1709420Species Influenza A virus, different strains [TaxId:11320] [58067] (95 PDB entries)
  8. 1709595Domain d4i78c_: 4i78 C: [252591]
    Other proteins in same PDB: d4i78a_, d4i78b_
    automated match to d4n5zb_
    complexed with nag

Details for d4i78c_

PDB Entry: 4i78 (more details), 3.18 Å

PDB Description: Crystal structure of a subtype H17 hemagglutinin homologue from A/little yellow-shouldered bat/Guatemala/060/2010 (H17N10)
PDB Compounds: (C:) hemagglutinin HA2

SCOPe Domain Sequences for d4i78c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i78c_ h.3.1.1 (C:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
iagfieggwqgmidgwygyhhenqegsgyaadkeatqkavdgitnkvnsiidkmnsqfes
nikefnrlelriqhlsdrvddalldiwsyntellvllenertldfhdanvknlfekvkaq
lkdnaidegngcflllhkcnnscmddikngtykymdyreeshiekqkids

SCOPe Domain Coordinates for d4i78c_:

Click to download the PDB-style file with coordinates for d4i78c_.
(The format of our PDB-style files is described here.)

Timeline for d4i78c_: