Lineage for d1e22a1 (1e22 A:11-153)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789271Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)
    barrel, closed; n=5, S=10
  6. 2789299Protein Lysyl-tRNA synthetase (LysRS) [50256] (3 species)
  7. 2789305Species Escherichia coli, gene lysU [TaxId:562] [50258] (5 PDB entries)
  8. 2789306Domain d1e22a1: 1e22 A:11-153 [25259]
    Other proteins in same PDB: d1e22a2
    protein/RNA complex; complexed with acp, gol, lys, mg

Details for d1e22a1

PDB Entry: 1e22 (more details), 2.43 Å

PDB Description: lysyl-trna synthetase (lysu) hexagonal form complexed with lysine and the non-hydrolysable atp analogue amp-pcp
PDB Compounds: (A:) lysyl-tRNA synthetase

SCOPe Domain Sequences for d1e22a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e22a1 b.40.4.1 (A:11-153) Lysyl-tRNA synthetase (LysRS) {Escherichia coli, gene lysU [TaxId: 562]}
aidfndelrnrreklaalrqqgvafpndfrrdhtsdqlheefdakdnqeleslnievsva
grmmtrrimgkasfvtlqdvggriqlyvardslpegvyndqfkkwdlgdiigargtlfkt
qtgelsihctelrlltkalrplp

SCOPe Domain Coordinates for d1e22a1:

Click to download the PDB-style file with coordinates for d1e22a1.
(The format of our PDB-style files is described here.)

Timeline for d1e22a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1e22a2